SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E3KCI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3KCI7
Domain Number 1 Region: 4-287
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-79
Family Capz beta-1 subunit 0.000000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E3KCI7
Sequence length 292
Comment (tr|A0A1E3KCI7|A0A1E3KCI7_9TREE) Uncharacterized protein {ECO:0000313|EMBL:ODO10821.1} KW=Complete proteome OX=1296118 OS=Cryptococcus amylolentus CBS 6273. GN=I350_01419 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Cryptococcus.
Sequence
MAEDQTFDSLLDLLRRLPPTKVEDNVNVLCDLAPEYADDLLGNVDQPLKVLSDDGEGREF
LGCDYNRDGDSFRSPWSNKYLPVDTQGPVPSSRLRQLEIALNSAFDTYREMYFEGGVSSV
YLWDLDDEPQGKEMAFAGVVLVKKTLSPQANVPTAPSGSWDSLHVFECQERGRSAKYKLT
STVMLLMDTKTLAKADEKGLENAEGKGNVALSGSMTRQAEIDYPLPTPQSHVANIGRMVE
DMELKMRNLLSAVYFGKTKDVVNELRSQAGLDAKSKEDLLRAELAGKLGGRK
Download sequence
Identical sequences A0A1E3I3X4 A0A1E3KCI7
XP_018997259.1.6790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]