SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E3NFQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3NFQ7
Domain Number 1 Region: 2-267
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-65
Family Capz beta-1 subunit 0.000000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E3NFQ7
Sequence length 277
Comment (tr|A0A1E3NFQ7|A0A1E3NFQ7_9ASCO) Uncharacterized protein {ECO:0000313|EMBL:ODQ44959.1} KW=Complete proteome; Reference proteome OX=763406 OS=Pichia membranifaciens NRRL Y-2026. GN=PICMEDRAFT_17464 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
Sequence
MSDEAYDASLDVLRRLDPKAITSNLSNICRLQPELAGDLLASVDAPLKSLKCPKSGKTFL
CCDYNRDGDSYRSPFSNQYVDADGSVGDDADAPKPSEHLRELELFANDSFDIYRDLYYEG
GVSSVYLWDNEDGDASADGKVGFDGVVLLKKTVEESSSWDSIHVFEIENATAGSSTYRLT
STILLDLSEANNDSTYLSGNLTRQTEREIAYKDSASHVANIGSLIEDVETQMRNMLQEVY
FGKTMDVLTDIRSLDALEDRQADRKRQENLIQRFESL
Download sequence
Identical sequences A0A1E3NFQ7
jgi|Picme1|99470|estExt_Genewise1Plus.C_3_t30442 XP_019016072.1.70258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]