SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E3NMD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3NMD8
Domain Number 1 Region: 1-272
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.41e-51
Family Capz alpha-1 subunit 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E3NMD8
Sequence length 279
Comment (tr|A0A1E3NMD8|A0A1E3NMD8_9ASCO) Uncharacterized protein {ECO:0000313|EMBL:ODQ46543.1} KW=Complete proteome; Reference proteome OX=763406 OS=Pichia membranifaciens NRRL Y-2026. GN=PICMEDRAFT_72603 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
Sequence
MVSEVESIVRQIVKTSPPGDDRTIIGDVKALLNNADADKLIAGVLRENYTTELAQDGKKG
GDAKLVRLSSGQHTIVSKYNLSGIKFFDIQQGIVFDYDFINGRVIDVEEKLPSGVDGKAV
EKLQEQLDDYIAAHYNELSRGMVIPGANDSLTVVIVGEKLNDSNFYNGKWAAVYEWDEQS
GRLSAVVKVRVHYYEDGNVVMNTAKEEDLGQISGVGAVIDKIAEYEKNYELSVLKKVNVL
NEQKFKNLRRLMPISRSKIQWGRAIGNYKLGQDVAGGRH
Download sequence
Identical sequences A0A1E3NMD8
XP_019017656.1.70258 jgi|Picme1|79434|CEP24014_9138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]