SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E3QIU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E3QIU4
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.19e-16
Family Ubiquitin-related 0.0014
Further Details:      
 
Domain Number 2 Region: 110-164
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000153
Family UBA domain 0.0019
Further Details:      
 
Domain Number 3 Region: 225-279
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0000000000000235
Family XPC-binding domain 0.0016
Further Details:      
 
Domain Number 4 Region: 292-340
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000914
Family UBA domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E3QIU4
Sequence length 341
Comment (tr|A0A1E3QIU4|A0A1E3QIU4_9ASCO) Uncharacterized protein {ECO:0000313|EMBL:ODQ77615.1} KW=Complete proteome; Reference proteome OX=984486 OS=Babjeviella inositovora NRRL Y-12698. GN=BABINDRAFT_168934 OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Babjeviella.
Sequence
MQVIFKDFKKEKIPIELELTDSVLAAKEKLAAIKECEAAQLKFVYSGKVLQDDKTLEDSK
IKEGDQVIFMLSKAKKTPTPAPQAETPLAVPVAAPVAAPVETAAEAAPAEDFTESTFATG
NSRETAIQNIMGMGFDRPQVEAALRAAFNNPDRAVEYLLTGIPESLQHRTAPEAPVAEST
EADVSMEETAVSPANSGNLFDAAAAAAAAEGQTAGAGGLGALPLEGQMDEIRAAIQENPE
MLAGILEQIAASNPELAEVIQANPEQFIRYLMEHGLGEEGEGDFGDAEGQVQIELSQEEA
DAVNRLCEMGFERGLVLQIYVACDKNEEMAANMLLSESFDD
Download sequence
Identical sequences A0A1E3QIU4
jgi|Babin1|168934|fgenesh1_pg.14_#_49 XP_018982943.1.12885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]