SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E3QMU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1E3QMU5
Domain Number - Region: 92-170
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0377
Family HEPN domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E3QMU5
Sequence length 179
Comment (tr|A0A1E3QMU5|A0A1E3QMU5_9ASCO) Protein YOP1 {ECO:0000256|RuleBase:RU362006} KW=Complete proteome; Reference proteome OX=984486 OS=Babjeviella inositovora NRRL Y-12698. GN=BABINDRAFT_168157 OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Babjeviella.
Sequence
MSDLQFKAKAFLTDMDRAFEGSHIFRQFEDNTGLPKSYGVLGGAGVYLFIIFLNVGGIGQ
LLSNIAGFVIPCYYSLLALETRTTADDTQLLTYWVVFAFLNVIEFWSKAILYWIPFYWLF
KTIALLYLALPQFGGATPVYNTFIKPFSEAYIIPRKSVASNLANTVEEVAEGVSSAVEH
Download sequence
Identical sequences A0A1E3QMU5
jgi|Babin1|168157|fgenesh1_pg.10_#_51 XP_018983740.1.12885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]