SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E4FUL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E4FUL1
Domain Number 1 Region: 39-115
Classification Level Classification E-value
Superfamily YdhA-like 0.0000000000000262
Family YdhA-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E4FUL1
Sequence length 120
Comment (tr|A0A1E4FUL1|A0A1E4FUL1_9PROT) Uncharacterized protein {ECO:0000313|EMBL:ODT74726.1} KW=Complete proteome OX=1660164 OS=Nitrosomonadales bacterium SCN 54-20. GN=ABS69_11675 OC=Bacteria; Proteobacteria; Betaproteobacteria; Nitrosomonadales.
Sequence
MKILLHTISFLSITITGWEHFSPASMSAASGTAAAGKSISYRCESGHSIDAVYRSGTTAI
VRYAGTSREMIIAVSASGARYVGKGLEWWTKGMGPGSTSTLFRHESDGTTGGIVERCKEQ
Download sequence
Identical sequences A0A1E4FUL1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]