SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E4SHJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E4SHJ6
Domain Number 1 Region: 4-275
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.02e-69
Family Capz beta-1 subunit 0.000000963
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E4SHJ6
Sequence length 287
Comment (tr|A0A1E4SHJ6|A0A1E4SHJ6_9ASCO) F-actin-capping protein subunit beta {ECO:0000313|EMBL:ODV78984.1} KW=Complete proteome; Reference proteome OX=984487 OS=Suhomyces tanzawaensis NRRL Y-17324. GN=CANTADRAFT_242682 OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Suhomyces.
Sequence
MSYEDKFDASLSLLRRLHPKQITANLDNICTLIQQNNGEDELVQDLLSSVDTPLKVVKCQ
DTGKPFLCCDYNRDGDSYRSPCSNKYFPVQADDDELPPFPSNTIRQLEIKANDAFDVYRD
LYYEGSGISSVYLWDTEDDETLDGFAGVVLIKKDTEDGSGKWNSIHVFEVIPESASTALY
KLTTSVILDLKNNDDSSLSLAGSLTRQLETIQTLEVDGGSNLETSHLINLGTLVEKSEYN
IRNLLQEVYFDKLKDIMLKDLRSVGDLGDQKLENLKQSELIKGLQGL
Download sequence
Identical sequences A0A1E4SHJ6
XP_020064106.1.41638 jgi|Canta1|242682|CE139636_8235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]