SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E4SWW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E4SWW2
Domain Number 1 Region: 2-275
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-68
Family Capz beta-1 subunit 0.000000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E4SWW2
Sequence length 292
Comment (tr|A0A1E4SWW2|A0A1E4SWW2_9ASCO) Uncharacterized protein {ECO:0000313|EMBL:ODV83999.1} KW=Complete proteome; Reference proteome OX=983967 OS=Candida arabinofermentans NRRL YB-2248. GN=CANARDRAFT_177178 OC=Ogataea/Candida clade.
Sequence
MSDEAFDASLDLLRRLDPKNISKNLNNICRLQPDLSDDLLSSIDTPLKVLKCSYNGDKLF
LCCDYNRDGDLYRSPWSNKYIGDNTADDDAPYPSSHLRQLEIYANESFDIYRDLYYEGGI
SSVYLWDGDDDDEQIVNKSGDVEFSGVALFKKQINKSLDDLNNGSWDSIHVFEINPLNGS
GAGSGEKFAEYKLTSTVILDLSTIENNDDISLSGNLTKQINKKIAYIDSMTHISNIGSII
ENMESNLRNMLQEIYFSKTKDIIGDLRTIEKLDVQNEDKLKHKELISSFQSL
Download sequence
Identical sequences A0A1E4SWW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]