SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E4TBU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E4TBU3
Domain Number 1 Region: 1432-1685
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-72
Family Capz beta-1 subunit 0.000000417
Further Details:      
 
Domain Number 2 Region: 374-503,686-822
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000589
Family Quinoprotein alcohol dehydrogenase-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E4TBU3
Sequence length 1693
Comment (tr|A0A1E4TBU3|A0A1E4TBU3_9ASCO) Uncharacterized protein {ECO:0000313|EMBL:ODV89128.1} KW=Complete proteome; Reference proteome OX=767744 OS=Tortispora caseinolytica NRRL Y-17796. GN=CANCADRAFT_3763 OC=Saccharomycetes; Saccharomycetales; Trigonopsidaceae; Tortispora.
Sequence
MHLYRELTKPTQVTAAVSCSLVSPKSQNLVIARSNLLQIYDVLETQISKDNDDHPLLNQD
ATEGEDQFIGDVIIAETQTSSSLNLIYEQTLSTSITALVAFRTIESSCDYIAISSPPSSF
SVVKWNSTDRSLLTVSLHDYENYSVDPSTQTVENGALPDSLRALHSESFGQDIRLVVDPA
NTAIIMFFQRQMFAVLPFSKHEYDEDPPARVPIIDAPETVMPLYWPSYVKTATQLIPGLT
NVIDFAFLYEYNDPTIAFLTFTEPTWTGLLPARQDTMQLYIVACDLLKGQFDLVVTIPKL
PYDLEYLVPLRGPSGGVMAVGANELVYIAPTGRIIAAPVNKFSEIGTHMTMVLGKKFEHL
DLFLEESKAIHLFGRNEILLFTNKGQTVVISLKLEGRLVESFSISLIDAPPVPHPRLIVP
FTQRTNVFVSSYVSDSYLFGWDISLAEKQLLDSVATTVAEMDDADDDDFLYSTTTKSKVG
AFQADSNSLTKLYLHDSLPNHGPILDIATGRCWVDNGAEIQTHSGTHEIVAARGQGSNCS
GISIFRQHITFPQRYGFEVMGCKGIWAIPTRQFNSLVTEMENESEVIDNLMFISENDKTL
VYRIEGEQFQSIDGSNEFNSDDSTVAVGTLLFNGLVVQITPIDIRIYDSELNVMQFIPLS
REVIERYAKRLRTREIGEDVTLLDDSYAHPLVSAYFADPHLVLLFEDGNLVIYSASTSTC
LLEKVSVPNIFSACRTVYAGILDSETTVFQPFMKDIANGIPTASEDVPMNNILSAEASSF
LKQAQVATSNRRILLALDMDGMLMAVTLSDLSVLWHIPDFADLPEITVVTPGSPKRAKDA
RQSISFQHGLARDPIVEVCLCAIGEPGNKQDVLVARTSTDHLMLYEFFWHDEVLRIKKIP
NLVFPKPLQEIEEQSFIFSFGLSRKKLYPINGMLFTRGLAPFVIVGTTHSKPHVYPVGGL
NGISGVSAIRTGVDAESANIIFCDGLGSVTVCSIPSDVDLSNTWITKKVNYDDIDDIQCI
SYYDPGQIYIIGASRDIDYRALDDEGLAIPNSNIIPPAPKTKKSVLRLITPRLWEAHIDE
YELDDGEAVTDMRVMQLDMSETDHSNLKWVLAVGTSIIRGEDLYERGYFYLFDIVGVVPE
PGHPERAFKLKLLTREDVASPVSHVCDVHGYLMTVQGNRAMLRSLRDDNSVVPSAFLDLN
LYTTQVKSIKDFMLFGDVLHGLYLTTFIRDPYRVVTLGKDQEKMHVAAADFVVDRAELYM
IAADVKGNLHILQYDPDDVKSFSGQNLLHRSEFYSGLKVQVFERIAVAQPSNDGYLDVIP
GVASLCIGGTQEGSLVSVSPISESSYRSLNYLQQQVWNRMDIVAGFNPRSYRQSKSNTRP
HAIPTFPRPVIDGSVISEFMFMSRRRQMEVSRRIGGNIGDLLGDIAELFWNSDEVFDAAL
DLLRRVNPRNVGSNLLEVCKLAPDLAADLLASVDQPLELKKCTSSGKMFLACDYNRDGDS
YRSPWSNEYQPPIAEGIKPSDAIRKLEIAANTAFGVYTDLYYERGHSSVYMWEVDDGFAG
VVLFRKDGSTNSVWHSIHVFEVIPSGSSSATYRLTSTIILNLAKTTAAAGSIDLGGNLSR
QFERNMSLDNSETAHVANIGRLVEESESKMRNQLQEVYFGKAQDIIGDLRSIVDLDTTKE
EGTRQKTMIAGLQ
Download sequence
Identical sequences A0A1E4TBU3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]