SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E5IHY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1E5IHY6
Domain Number - Region: 14-48
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0628
Family Skp1 dimerisation domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E5IHY6
Sequence length 77
Comment (tr|A0A1E5IHY6|A0A1E5IHY6_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OEG70102.1} KW=Complete proteome; Reference proteome OX=1408204 OS=Candidatus Endomicrobium trichonymphae. GN=ATZ36_06175 OC=Endomicrobiaceae; Endomicrobium.
Sequence
MHSIIFFRFIEILNFVSLNRRFQIMSASGYLNARLLSITTKQTVSLILNKLVGLGPKLFC
VYFFSGDAERQESFYIA
Download sequence
Identical sequences A0A1E5IHY6
2021698351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]