SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E5NW11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1E5NW11
Domain Number - Region: 102-157
Classification Level Classification E-value
Superfamily TIMP-like 0.029
Family Tissue inhibitor of metalloproteinases, TIMP 0.034
Further Details:      
 
Domain Number - Region: 234-295
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0811
Family Capz beta-1 subunit 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E5NW11
Sequence length 325
Comment (tr|A0A1E5NW11|A0A1E5NW11_9SPIR) Uncharacterized protein {ECO:0000313|EMBL:OEJ20365.1} KW=Complete proteome OX=1287055 OS=Brachyspira hampsonii. GN=A9495_12390 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MLFVKNKIILLMIILLFSINAYSITITILPFESADETWIEEYKVDDGIPRVLEDSLINKK
MLDVTDYDLLISYFSSYDIVASYKSMQTNLQLASDFIKETFNSDYIITGEILNFNLKKGG
KDTANVEFKVNLIDIKSLKIVKTFKDKGNYTLPNSSPVYSAEDALFTETALGAASAIALS
KIADSITEYLGNPPLVGIVTRIEDSKLYINLGKNNNIKIGDEFSIYKRDKVLQLPNYQNN
STNNISNIPKIQFADNTEKGYISVRSNEKGDVWYTSEMLYKYRFYKNEETFITSAKVVEI
YDYYAILENKSDEVIEPMMIVKIKE
Download sequence
Identical sequences A0A1E5NW11
WP_008726384.1.101799 WP_008726384.1.32107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]