SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E5Q0N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E5Q0N4
Domain Number 1 Region: 35-123
Classification Level Classification E-value
Superfamily Barstar-related 0.000000419
Family Barstar-related 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E5Q0N4
Sequence length 130
Comment (tr|A0A1E5Q0N4|A0A1E5Q0N4_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:OEJ35192.1} KW=Complete proteome; Reference proteome OX=36818 OS=Streptomyces subrutilus. GN=BGK67_31245 OC=Streptomyces.
Sequence
MLVWACGAKTSGRSAWLDLTCTGPYGPGIGRSGGTYHLDGQHVTDKPGLLLALGEALLGP
GSAYGRGLDSVDYHLGGGLSVVPPFTLIWHRADIARHALARHTVDHRPDRSYFEVAVRIL
REHGVTVVLQ
Download sequence
Identical sequences A0A1E5Q0N4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]