SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E5RHV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E5RHV7
Domain Number 1 Region: 14-314
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.76e-50
Family Capz alpha-1 subunit 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1E5RHV7
Sequence length 321
Comment (tr|A0A1E5RHV7|A0A1E5RHV7_9ASCO) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:OEJ86467.1} KW=Complete proteome; Reference proteome OX=56408 OS=Hanseniaspora osmophila. GN=AWRI3579_g1386 OC=Saccharomycetes; Saccharomycetales; Saccharomycodaceae; Hanseniaspora.
Sequence
MVLISSTMNPLTSMESILRKLVAQALPQEMPHVSKDLLAVIDAXKATEAGSSSAVSLKKQ
LAKVIESYNENNFVSVSWEHDNKLEHSIVSKYNKLGSRYIDYTKGKTFQVDHLTLTGSDV
EDYDNTDNSVDMEAIQKLSAGLQKHAEXITTDVGLVNFAVFPXTESFESDAETEVSEQSS
XPINSYVLVITITKNNEPNYWNGVWKAVYTYTEAAEATVEGQVQCDVHYFEEGNVKYNHT
ETLPSTAVSCGADTKNVEQVLGIISEFEASLDDKIIKSFLDMNETGFKNLRRILPVTRSK
INWGKSIGNYKLGKDASSSGL
Download sequence
Identical sequences A0A1E5RHV7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]