SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1E5TSD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E5TSD8
Domain Number 1 Region: 5-251
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.16e-63
Family LplA-like 0.0000218
Further Details:      
 
Domain Number 2 Region: 254-339
Classification Level Classification E-value
Superfamily SufE/NifU 7.85e-23
Family SP1160 C-terminal domain-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E5TSD8
Sequence length 340
Comment (tr|A0A1E5TSD8|A0A1E5TSD8_9STAP) Lipoate--protein ligase {ECO:0000256|SAAS:SAAS00603724} KW=Complete proteome OX=246432 OS=Staphylococcus equorum. GN=AST02_06035 OC=Staphylococcus.
Sequence
MYLIEPIRNGEYITDGAVALAMQIHVSQNIFLNEDILFPYICDPKVEIGRFQNTAVEINQ
DYLDEHGIQVVRRDTGGGAVYVDSGAVNMCCILEKDDTIYGNFKRFYEPGIQALHQLGAT
EVVQSGRNDLAIHDKKVSGAAMTLIKGRIYGGYSLLLDVDYEPMVKVLKPNRKKIESKGI
KSVRSRVGNIREYLAPEYQNVTIHEFKDLMVKEILGIDDTNDAKRYELTDADWEAVDEML
ASKYKNWEWNFGGSPRYEYNRDARLAAGTIDVSLSVEKGRISACRIYGDFFGQGDIKDVE
EQLKDVRVVKEDLLKALSEIDITYYFGKATAEELVDVILS
Download sequence
Identical sequences A0A1E5TSD8
WP_069816522.1.13011 WP_069816522.1.31112 WP_069816522.1.84158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]