SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E7EXA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1E7EXA1
Domain Number - Region: 330-384
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000201
Family Capz beta-1 subunit 0.01
Further Details:      
 
Domain Number - Region: 65-139,195-237
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000235
Family Capz beta-1 subunit 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1E7EXA1
Sequence length 628
Comment (tr|A0A1E7EXA1|A0A1E7EXA1_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OEU10477.1} KW=Complete proteome; Reference proteome OX=635003 OS=Fragilariopsis cylindrus CCMP1102. GN=FRACYDRAFT_246923 OC=Bacillariophycidae; Bacillariales; Bacillariaceae; Fragilariopsis.
Sequence
MAATTTTTTTTTKTILSKVDPFILDGTIRNLDKLLGSSGSSGLLLPLKASNTTNGSGNSN
DDTSDRRQYLETFFNKLDGGNKYRNPFVIKNNNNEDEDEEIFKLESSANEVWDAYRQLYY
GHDNSIGSVYFRRKGSGSDSSSGGESSPSSGTTTGTGSGGGLEAFFGIQKKCFTTDENKN
DDENSSSTNNAGGEGEKGDENEFARWESVHYITIQEPNYDNNTCEYKINSTIWCRFQPED
VGDIPPLLKQKQKQKKTAAPVIKKVPPAAAKPKSPTFKGLERARLEIFDKAKDNWDSRHN
KKVDEEEEKKKKIAALQPRTPINSSPIPAVVTSSSYHEEETIKVIPIASHIHNIGTEIEK
LESNYRKRLEMIHISKTCEILQGMYSGGGGSNGTTSQTQTQARPAGLHKHATGMGVGASL
IGEIALKAKLKGLGNSCNGDGGSPSDNNDNNDSSTGGTGTGGTESKDTNKAMESILAAEK
KKKLSQEDNTNAADTKINDWKSNLKKTTSTNTNTAPPPTGTTTATSANTTNDWKSGLKKT
TTTTASSKATTTTSNNENNSTTTYLQASLKKTTKPSTATSTATKTATPEFLDFRKCMPLR
TNSFHVYRSSSNEYCTLGSKLLAASRPP
Download sequence
Identical sequences A0A1E7EXA1
jgi|Fracy1|246923|fgenesh2_pg.19_#_96

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]