SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E7F9Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E7F9Q7
Domain Number 1 Region: 251-287
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000384
Family MYND zinc finger 0.016
Further Details:      
 
Weak hits

Sequence:  A0A1E7F9Q7
Domain Number - Region: 278-357
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00157
Family Capz alpha-1 subunit 0.016
Further Details:      
 
Domain Number - Region: 23-49
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0497
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E7F9Q7
Sequence length 398
Comment (tr|A0A1E7F9Q7|A0A1E7F9Q7_9STRA) Uncharacterized protein {ECO:0000313|EMBL:OEU14869.1} KW=Complete proteome; Reference proteome OX=635003 OS=Fragilariopsis cylindrus CCMP1102. GN=FRACYDRAFT_241426 OC=Bacillariophycidae; Bacillariales; Bacillariaceae; Fragilariopsis.
Sequence
MTSITASTTTGTNTTTTSVVLVQQQRQQQQQRQQQQLFIQNNHNSFPIQLKSKKLYEQGQ
RLQKQKCYTKAIHKYLRGAEMTGCLHCIFDYIELLRFVHKNKNKNKKTTTTTSTINHLIL
PWLLEGAIRGHLYSIIRLYLSCYTEALPSQAHALIEYWLKMEQSLYPNLDDNQNNTTNNN
NTGTIKAGRQKAKKTVVSSCPICYKTDDDLSDDDDDEDSTSNDNNDNDGGDDGGSSTSTQ
GMTKTKTKTKAKLKQCMGCQMYCYFSEECQTTHWIQQNHRNECKMIQLLQKYHKPYSKEI
YQNQIINIIAAPTSSIQQQQQQQQQHREREHVDKNNNRLQILRDKLGLNRPKIDYEELVL
LLSTDNDNHNNDNSDRRRHYLVARQDGTVHIGSTPNVI
Download sequence
Identical sequences A0A1E7F9Q7
jgi|Fracy1|241426|fgenesh2_pg.8_#_728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]