SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F0H1Z1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F0H1Z1
Domain Number 1 Region: 34-121
Classification Level Classification E-value
Superfamily TPR-like 0.00000277
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 
Weak hits

Sequence:  A0A1F0H1Z1
Domain Number - Region: 126-189
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 0.0183
Family Lipovitellin-phosvitin complex, superhelical domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F0H1Z1
Sequence length 267
Comment (tr|A0A1F0H1Z1|A0A1F0H1Z1_9NEIS) Outer membrane protein assembly factor BamD {ECO:0000256|HAMAP-Rule:MF_00922} KW=Complete proteome OX=1739524 OS=Neisseria sp. HMSC065C04. GN=HMPREF3022_01140 OC=Neisseriaceae; Neisseria.
Sequence
MKKILLVVSLGLALSACANKGTIDKDAQITQDWSVEKLYAEAQDELNSNNYTRAVKLYEI
LESRFPNGRYAQQSQLDTAYAYYKDDEPEKALAAIARFQRHHPQHPNMDYALYLKGLVLF
NEDQSFLNKLASQDWSDRDPKANRDAYQAFAELVQRYPNSKYAADATERMAKLVDALGGN
EISVARYYMKRGAYVAAANRAQKIVSRYQNTRYVEEALAMMELAYKKLDKPQLAADTRRV
LETNFPQSPFLQHEWRSDDMPWWRYWR
Download sequence
Identical sequences A0A154U9B1 A0A1F0H1Z1 A0A1F1FQE0 A0A1F1I096 A0A2I1QYK2 C0ENN8
WP_003680807.1.100293 WP_003680807.1.14574 WP_003680807.1.20812 WP_003680807.1.22879 WP_003680807.1.24618 WP_003680807.1.30662 WP_003680807.1.31159 WP_003680807.1.36168 WP_003680807.1.45944 WP_003680807.1.57955 WP_003680807.1.58979 WP_003680807.1.62794 WP_003680807.1.7160 WP_003680807.1.71740 WP_003680807.1.7663 WP_003680807.1.83931 WP_003680807.1.85054 WP_003680807.1.86926 WP_003680807.1.88370 WP_003680807.1.95749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]