SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F1A6S2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1F1A6S2
Domain Number - Region: 14-90
Classification Level Classification E-value
Superfamily MtlR-like 0.034
Family MtlR-like 0.025
Further Details:      
 
Domain Number - Region: 83-124
Classification Level Classification E-value
Superfamily GAT-like domain 0.0863
Family Phosphoinositide-binding clathrin adaptor, domain 2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F1A6S2
Sequence length 139
Comment (tr|A0A1F1A6S2|A0A1F1A6S2_9STRE) Uncharacterized protein {ECO:0000313|EMBL:OFQ88902.1} KW=Complete proteome OX=1739421 OS=Streptococcus sp. HMSC061E03. GN=HMPREF2917_03250 OC=Streptococcus.
Sequence
MKTYKKYVVFSSQQYISELINLNEEINIRMFYSTFEDDQYISILNDQDQELSFNFVNDSI
EFELIDPLCEKILITFDTVEQTAKVHQVIKFLLDLFFKFNWHESVAALSVADFWELIKNY
EKDNLDMTFGYPRISGSNS
Download sequence
Identical sequences A0A1F1A6S2 A0A2I1TW48 T0U389
WP_021153277.1.51071 WP_021153277.1.86592 WP_021153277.1.97022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]