SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F1SRS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F1SRS5
Domain Number 1 Region: 80-203
Classification Level Classification E-value
Superfamily NosL/MerB-like 5.23e-41
Family MerB-like 0.0000493
Further Details:      
 
Domain Number 2 Region: 20-79
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.85e-17
Family MerB N-terminal domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1F1SRS5
Sequence length 220
Comment (tr|A0A1F1SRS5|A0A1F1SRS5_9MICC) Alkylmercury lyase {ECO:0000313|EMBL:OFT04467.1} KW=Complete proteome OX=1581070 OS=Micrococcus sp. HMSC30C05. GN=HMPREF3102_11430 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Micrococcus.
Sequence
MNNISEVTDRLASNETGMEPWLWMPLLKLLALGDPVDVSDLAAATGRAGEEVRTALKAMG
DTEYDGSGRIIGQGLTQRPTQHRFEVNGEQLYTWCALDTLIFPTLLGASARIESSHQATG
TPVRVAVTAMGVTSVEPATAVVSLVNPEDISSVRSSFCNQVHFFASPDDAAPWLETHPGG
TIMPVKEAYELGSSMAEKMLTHTPGPATDQVSNGVQSCAC
Download sequence
Identical sequences A0A031HGR4 A0A1F1SRS5 A0A229HK30 A0A2A9K328
WP_036336638.1.101416 WP_036336638.1.12817 WP_036336638.1.43700 WP_036336638.1.46588 WP_036336638.1.9158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]