SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F1UMU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F1UMU2
Domain Number 1 Region: 71-140
Classification Level Classification E-value
Superfamily YdhA-like 0.00000000000785
Family YdhA-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1F1UMU2
Sequence length 154
Comment (tr|A0A1F1UMU2|A0A1F1UMU2_9NEIS) Uncharacterized protein {ECO:0000313|EMBL:OFT27426.1} KW=Complete proteome OX=1581049 OS=Neisseria sp. HMSC03D10. GN=HMPREF3066_00920 OC=Neisseriaceae; Neisseria.
Sequence
MKSKVLLAVAAALSLGACVAPDMDYDFERGSRHEHRHEHRYDNRDDNYDRNEMRREERRY
EENRRTSESRRLRTFSCENGLSVDVRNLNNDQLELRLDDKRAVLSSDVSGSGSRYTSNRG
LFGEGAEWHEKNGEASFSFTDPYGNRVETSCSVR
Download sequence
Identical sequences A0A1F1UMU2
WP_070439859.1.15766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]