SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F2G9H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1F2G9H8
Domain Number - Region: 82-191
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.00144
Family V-type ATPase subunit E 0.023
Further Details:      
 
Domain Number - Region: 26-91
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0628
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F2G9H8
Sequence length 196
Comment (tr|A0A1F2G9H8|A0A1F2G9H8_9STRE) ATP synthase subunit E {ECO:0000313|EMBL:OFU69485.1} KW=Complete proteome OX=1581076 OS=Streptococcus sp. HMSC10A01. GN=HMPREF3108_09620 OC=Streptococcus.
Sequence
MSDISDLKASVLEQAHEKGRLLLAEATEKIEQEAKEREAQLVRQKLGQREQQLKEISRRS
QRDIQQLENQKRQSTLVIKQRVLRELFEEAYAQMSAWSLAEEEHFLKSVLAKYPEEELTL
TFGALSAEKFNSSQLEGLKKVFPQVHFSDQFIADQAGFVLSQGRVDDSYLYRDLLDSVWQ
EESYRLAQDIFKDQAE
Download sequence
Identical sequences A0A1F2G9H8 D0RS65
WP_008808155.1.1781 WP_008808155.1.42702 WP_008808155.1.85835 WP_008808155.1.97211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]