SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F2PB65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F2PB65
Domain Number 1 Region: 6-87
Classification Level Classification E-value
Superfamily AF1782-like 4.32e-23
Family AF1782-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1F2PB65
Sequence length 92
Comment (tr|A0A1F2PB65|A0A1F2PB65_9EURY) Uncharacterized protein {ECO:0000313|EMBL:OFV68478.1} KW=Complete proteome; Reference proteome OX=1838285 OS=Candidatus Syntrophoarchaeum caldarius. GN=SCAL_000154 OC=ANME-2 cluster; Candidatus Syntrophoarchaeum.
Sequence
MSDDVKADLYEKTERYCRMLADALESLRVTPMGESMKDVVDEFRTMATAYYRDGIHFRDA
EDWVNALICFTYGHGWIDAGVRLGIMECDSSC
Download sequence
Identical sequences A0A1F2PB65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]