SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F2V7E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F2V7E0
Domain Number 1 Region: 26-64
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.000000124
Family PsbU-like 0.03
Further Details:      
 
Domain Number 2 Region: 86-129
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000889
Family ComEA-like 0.021
Further Details:      
 
Domain Number 3 Region: 144-190
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000148
Family ComEA-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F2V7E0
Sequence length 208
Comment (tr|A0A1F2V7E0|A0A1F2V7E0_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OFW40921.1} KW=Complete proteome; Reference proteome OX=1797193 OS=Acidobacteria bacterium RIFCSPLOWO2_12_FULL_67_14b. GN=A3J29_22740 OC=Bacteria; Acidobacteria.
Sequence
MTRTLALLLALAFATPAFAQVGKSLGVVDANTASEADLAAMPGMTPAIAKALVAARPFDS
IVALNTFLLGQKLTPEQANAFYQKAFIHINLNTATGEEILLVPGAGKRMAREFAEYRPWK
SYAQFEKEIGKYVDAKEVARLAQYTFIPVNLNTATDDDILSIPGAGRRMVREFKEYRPWK
TPAQFEKEIGKYVDAKEVKRLWRYVVIQ
Download sequence
Identical sequences A0A1F2V7E0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]