SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F5ZP06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F5ZP06
Domain Number 1 Region: 144-209
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 6.54e-16
Family PsbU-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F5ZP06
Sequence length 210
Comment (tr|A0A1F5ZP06|A0A1F5ZP06_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OGG13822.1} KW=Complete proteome; Reference proteome OX=1798375 OS=Candidatus Gottesmanbacteria bacterium RIFCSPHIGHO2_01_FULL_39_10. GN=A2773_05695 OC=Bacteria; Candidatus Gottesmanbacteria.
Sequence
MTDETGQSGSSSFYKQIFSIASDNRIALFIATAGIVFIVSSLFFLFKKDTGGEVVFTENS
ASDSGEIKIVVDIEGSVMNPGVYTLESGARVGDLLIMAGGYTEGADREWTAKYLNQAAKL
TDGGKIYIPQAGEEIAKTSLLGTADSVSTGEKININTATLTELDKLPGVGQVTAGKIISG
RPYLTAEELNTKKIVGNAVWEKIRELVVVY
Download sequence
Identical sequences A0A1F5ZP06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]