SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F6TYM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F6TYM7
Domain Number 1 Region: 9-74
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.000000000000034
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F6TYM7
Sequence length 184
Comment (tr|A0A1F6TYM7|A0A1F6TYM7_9PROT) Uncharacterized protein {ECO:0000313|EMBL:OGI50211.1} KW=Complete proteome; Reference proteome OX=1817768 OS=Candidatus Muproteobacteria bacterium RIFCSPLOWO2_01_FULL_60_18. GN=A3A87_07775 OC=Bacteria; Proteobacteria; Candidatus Muproteobacteria.
Sequence
MNMSNTDDMKEKLSALVDNELDDLDERRVMAALEKDVDLRRTWERYHLVRSALHQDLSMF
VPQDMATRVAARIGMEPANVASFRRQKITRLAGTLAIAASVAAIAVTGVQWINRPASAPL
APLAAVQTAPEKIIRAGTTHWDTKEPEAESALNAFLVEHNEFASSSSIGGMMPYVRVVGY
DNPK
Download sequence
Identical sequences A0A1F6TYM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]