SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F7RAZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F7RAZ9
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.00000286
Family HEPN domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1F7RAZ9
Sequence length 93
Comment (tr|A0A1F7RAZ9|A0A1F7RAZ9_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OGL38735.1} KW=Complete proteome; Reference proteome OX=1817876 OS=Candidatus Schekmanbacteria bacterium GWA2_38_11. GN=A2042_06710 OC=Bacteria; Candidatus Schekmanbacteria.
Sequence
MEFIGHLVIEKLLKAYYVRTVDINHPFIHDLLKIAQKTDLRLTKVQEDFLDVVTTFNLGT
RYSDYKMTGETPVPPTDSLKKSFLISVIFILSL
Download sequence
Identical sequences A0A1F7RAZ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]