SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F8MEM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F8MEM9
Domain Number 1 Region: 50-121
Classification Level Classification E-value
Superfamily CPE0013-like 6.28e-23
Family CPE0013-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1F8MEM9
Sequence length 123
Comment (tr|A0A1F8MEM9|A0A1F8MEM9_9CHLR) Uncharacterized protein {ECO:0000313|EMBL:OGN97051.1} KW=Complete proteome; Reference proteome OX=1797625 OS=Chloroflexi bacterium RBG_13_51_36. GN=A2Z77_03080 OC=Bacteria; Chloroflexi.
Sequence
MAAEKKHFVCVVCPIGCEIDVVYDGSEIISMEGNKCEKSEEFVRQELIGPMRILTTTVRI
QGSRLPVIPVRTDKSVPKRLFPRMMKQLRRIKLQAPVNMLDVVARDVLHTGANIIATRTM
LRE
Download sequence
Identical sequences A0A1F8MEM9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]