SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1F9YNQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F9YNQ0
Domain Number 1 Region: 8-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000000706
Family Preprotein translocase SecE subunit 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1F9YNQ0
Sequence length 76
Comment (tr|A0A1F9YNQ0|A0A1F9YNQ0_9EURY) Protein translocase SEC61 complex subunit gamma {ECO:0000313|EMBL:OGS41245.1} KW=Complete proteome; Reference proteome OX=1797976 OS=Euryarchaeota archaeon RBG_13_31_8. GN=A3K77_00930 OC=Archaea; Euryarchaeota.
Sequence
MEKAWDLQHKIEDRESRFGKGKYGRVFKMARKPTDEEYSKTSKITGAGILAIGGLGFLIF
LIAKEVAPWVVDLLGL
Download sequence
Identical sequences A0A1F9YNQ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]