SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G0ZD58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G0ZD58
Domain Number 1 Region: 2-223
Classification Level Classification E-value
Superfamily Dipeptide transport protein 2.35e-61
Family Dipeptide transport protein 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G0ZD58
Sequence length 253
Comment (tr|A0A1G0ZD58|A0A1G0ZD58_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OGV56164.1} KW=Complete proteome; Reference proteome OX=1798574 OS=Lentisphaerae bacterium GWF2_50_93. GN=A2X45_11765 OC=Bacteria; Lentisphaerae; unclassified Lentisphaerae (miscellaneous).
Sequence
MVDMEGVSGICRVSQVMQGQPDYDKSRKYITWDVNSCVKGCFDGGAKRVLVRDAHCTGFN
LLWDELDPRAEYIQGDSGTERMPGLDSFDGMILLGYHAMAGTSSAVLEHTMSSAGWQHFW
LNGAKAGEIAIDAGIAGDHNVPVIMVSGDDKACAEARRLLRGVVTAEVKKGLSREGAILL
AKDKAHMLIAECAAAAVRNFGNVKPLRIRRPVKMRLELVSKSKVPGERDNLKVINGRTYE
VTGPDVEKALKLL
Download sequence
Identical sequences A0A1G0ZD58

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]