SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G1HSB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G1HSB3
Domain Number 1 Region: 14-130
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 3.61e-21
Family HEPN domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G1HSB3
Sequence length 148
Comment (tr|A0A1G1HSB3|A0A1G1HSB3_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OGW59151.1} KW=Complete proteome OX=1801722 OS=Nitrospirae bacterium RIFCSPLOW2_12_42_9. GN=A2Y48_02805 OC=Bacteria; Nitrospirae.
Sequence
MPKPEHIIAVAREWIVKAENDLKNAANTLKMGEDCPTDTVCFHAQQCAEKYLKALLVWKG
IPFPKTHDLPSLMAILPEDLHNLLTGEEQELLTEYATVTRYPGGYEDITLSEARSAVRVA
RRIRKDIRALLPREVLQSERKKMQRRRK
Download sequence
Identical sequences A0A1G1HSB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]