SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G2YWR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G2YWR3
Domain Number 1 Region: 7-125
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 1.14e-20
Family HEPN domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G2YWR3
Sequence length 127
Comment (tr|A0A1G2YWR3|A0A1G2YWR3_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OHB62852.1} KW=Complete proteome; Reference proteome OX=1801963 OS=Planctomycetes bacterium RBG_13_60_9. GN=A2Y76_03255 OC=Bacteria; Planctomycetes.
Sequence
MDDLSRQWAERAQYDLDTADAMFKAERHLYVLFCCQQAVEKALKAVIVKKTGELPPRIHN
LLRLAETAGMQSSEEQIDLFTKLSAYYIQTCYPEEIMAAGAGTTPELAREALGRTERTVK
WVLSILQ
Download sequence
Identical sequences A0A1G2YWR3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]