SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G3UI93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G3UI93
Domain Number 1 Region: 54-141
Classification Level Classification E-value
Superfamily NosL/MerB-like 0.000000000628
Family NosL-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1G3UI93
Sequence length 143
Comment (tr|A0A1G3UI93|A0A1G3UI93_9HELI) Uncharacterized protein {ECO:0000313|EMBL:OHE15429.1} KW=Complete proteome; Reference proteome OX=1802257 OS=Sulfurimonas sp. RIFOXYB2_FULL_37_5. GN=A2329_00230 OC=Helicobacteraceae; Sulfurimonas.
Sequence
MLKFKLLLFSFMMFFLIGCEQKVQNGPAKINWDRDMCDRCVMVLSDRKNTVQLKHPSTKK
VYKFDDIGCMALWFDEEKIEFKDSAEIWITDAISGEWCDARAAFYTSQNVTPMAFGFSAY
KLKESIKTGEEILTYDEVLKKIK
Download sequence
Identical sequences A0A1G3TIY8 A0A1G3UI93

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]