SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1G4GYE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4GYE3
Domain Number 1 Region: 10-304
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-68
Family Capz alpha-1 subunit 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G4GYE3
Sequence length 312
Comment (tr|A0A1G4GYE3|A0A1G4GYE3_PLAVI) F-actin-capping protein subunit alpha, putative {ECO:0000313|EMBL:SCO67613.1} KW=Complete proteome OX=5855 OS=Plasmodium vivax (malaria parasite P. vivax). GN=PVT01_100007800 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MKDDKMESLLNEKKNFIRHVLMNAPPGKVADLVSDLKTLFGTSVVIQNSIEEAVAAHSEK
NYAIIPLSGDEYVITCEESKVGNSYLQPKLKSLLDVNHLKKKVNTMEDFEELSYPELLEN
YRKSCSAKLEEYVQAHYSNWNELQTINYPTVNINSKNGLSVKCCSSVYATEREGRFNLLL
IVCCDRHYLKNFHASSWRSSWNVTFLTTDEEVLLNGTIDVVLTYFEDANINFKATKNFEK
TVHVNNDVDTFSANILSAIRECENCALYELNEFLLHIDKELIKNTRKIIPFNGDKFDWKE
TYQDIPAQINDS
Download sequence
Identical sequences A0A1G4GYE3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]