SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1G4GYN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4GYN7
Domain Number 1 Region: 3-249
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.49e-52
Family Capz beta-1 subunit 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G4GYN7
Sequence length 304
Comment (tr|A0A1G4GYN7|A0A1G4GYN7_PLAVI) F-actin-capping protein subunit beta, putative {ECO:0000313|EMBL:SCO67724.1} KW=Complete proteome OX=5855 OS=Plasmodium vivax (malaria parasite P. vivax). GN=PVC01_100025200 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MEEAKIEAALHICNLLPAHVFEETIKLLSKVDQNLTNNILINKEGPIKIKFDSQQNKHYL
GNMFNKEKDSYRSPYSNRYYPEHYPNGYIPSESLRMLEMLYNEMYDRYRKAYYIGGLSSV
YLWPNPIEEGFVACFLIKKKENYDPCTSLTWEGTHLIQVSITHARVYYQISTTVNFFIKK
KNEMTLSASINKALETPKKVSNVNLVKDKYFHMHNMGKMIEGIENSLRKSIEYIYLPKMN
DILNSIRMDDSFASAWHNADRKAAQNLRTISSNIALSRGSVQDELRLKLKGRSFDAGAEY
SLRT
Download sequence
Identical sequences A0A0J9SE00 A0A0J9STR8 A0A0J9VY95 A0A0J9WDL9 A0A1G4GYN7 A5K9I3
5855.PVX_080370 gi|156095494|ref|XP_001613782.1| gb|PVX_080370 XP_001613782.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]