SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4GYY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4GYY2
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily RING/U-box 0.00000125
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Weak hits

Sequence:  A0A1G4GYY2
Domain Number - Region: 72-144
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0288
Family IP3 receptor type 1 binding core, domain 2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G4GYY2
Sequence length 260
Comment (tr|A0A1G4GYY2|A0A1G4GYY2_PLAVI) CDK-activating kinase assembly factor, putative {ECO:0000313|EMBL:SCO67776.1} KW=Complete proteome OX=5855 OS=Plasmodium vivax (malaria parasite P. vivax). GN=PVC01_100030500 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MDEYKCSCCQDDVCTSSEKKLFYFDVCKHKICGECLESQLSQHNKQHCPRCKIGVTKKNV
TPFDIEERVYSNQKNIRSKLTEIFNQKRHNFESTPQYNNYLEQIEDIIYLLTNEADEKKR
KIIEAYIKKYERENQKVIEENNVILFENEKKKIHDIVKKEGNFYEIIKHRPLIKKSHNEV
FVHSLVKENPKLFDEIKVTNITESQPQPLNPAIKNDTDIPLRRFSSEQELKKSDHAGGYD
TSIVFKRCHTEFNSTIYLNI
Download sequence
Identical sequences A0A0J9SBG5 A0A0J9STF4 A0A0J9TCF0 A0A0J9TUK1 A0A1G4GYY2 A5K9N4
gb|PVX_080625 XP_001613833.1.43797 gi|156095596|ref|XP_001613833.1| 5855.PVX_080625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]