SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1G4IP87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4IP87
Domain Number 1 Region: 60-314
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.59e-63
Family Capz beta-1 subunit 0.000000839
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1G4IP87
Sequence length 333
Comment (tr|A0A1G4IP87|A0A1G4IP87_9SACH) LAFA_0A05864g1_1 {ECO:0000313|EMBL:SCU78284.1} KW=Complete proteome OX=433476 OS=Lachancea sp. CBS 6924. GN=LAFA_0A05864G OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
Sequence
MIKSCFIVTSLPCLYSFIDFLLLRPGYINLLPTLNQILSPAKSTWENKTHEQHTTRTMSS
LDAALDILRRLDPTKIEENLSQLIKLDPNLAEDLLTSVDTPLQVKKDPHASQKEFLTCDY
NRDIDSHRSPWSNRYVPDLSPEDLAESPFPTDSVRRTEVLANDSLDIYRDLYYEGGVSSV
YLWDLGDDTEEFAGVVLLKKGTQSKSSWDAIHVFEALQTEGSSQWTYRLTTTTILHLDSG
REMHLSGNLTRQTEKEVSRPASVSEGSDAFRVWHIANLGALVEEVESQMRNQLEVVYFDK
TRDIYRELRDETQASSASSRSAHQEVVKGLQGM
Download sequence
Identical sequences A0A1G4IP87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]