SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4ISU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4ISU5
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 9.15e-42
Family Arp2/3 complex 16 kDa subunit ARPC5 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G4ISU5
Sequence length 153
Comment (tr|A0A1G4ISU5|A0A1G4ISU5_9SACH) Actin-related protein 2/3 complex subunit 5 {ECO:0000256|RuleBase:RU004301} KW=Complete proteome OX=433476 OS=Lachancea sp. CBS 6924. GN=LAFA_0B06942G OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
Sequence
MEDWRRIDIDAFDPDSGRLVPEDLTPPNLKPVNAGEIESKISQLRSAATSGDFSTALQLV
TNDPPYSADETTKSRYFEAVLSALTQVRQAEIANLVKQLSPAQTDVLIKYLYKGMSVPEG
QKQGGILLSWFEKVTQDTGVAPVVRYLSDRRTV
Download sequence
Identical sequences A0A1G4ISU5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]