SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4KZ73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1G4KZ73
Domain Number - Region: 17-77
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0628
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G4KZ73
Sequence length 122
Comment (tr|A0A1G4KZ73|A0A1G4KZ73_BACCE) Uncharacterized protein {ECO:0000313|EMBL:SCV20442.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=BCRIVMBC845_02960 OC=Bacillus cereus group.
Sequence
MSNLGMDLSDSRLIVANVEEKEYHFIVREHPIVGKIISLLENGKEYGLIDKQIANNDKFI
ISELTKLDYFNIDVLYYTPGWIWIGMDQFGLHAREATYNEVDVIMKLKEDLYYIDVYEKV
KM
Download sequence
Identical sequences A0A1G4KZ73 A0A2B4NL86
WP_016087457.1.15502 WP_016087457.1.44449 WP_016087457.1.55788 WP_016087457.1.64615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]