SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G4MKW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4MKW8
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily HSP20-like chaperones 4.01e-26
Family Co-chaperone p23-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G4MKW8
Sequence length 244
Comment (tr|A0A1G4MKW8|A0A1G4MKW8_LACFM) LAFE_0H15896g1_1 {ECO:0000313|EMBL:SCW04545.1} KW=Complete proteome; Reference proteome OX=4955 OS=Lachancea fermentati (Zygosaccharomyces fermentati). GN=LAFE_0H15896G OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
Sequence
MALTPEVLWAQRSSDSDKDKNYLLVTLLIPDCEQPHLDLDATHLEFTAKSPGHVGDEHEH
KYHLRIDFYKEIDPESSLHKVANGRDYFLKLYKKDLDAEYWPRLTKEKLKYHFIKTDFDK
WVDEDEQEEHVDEDFGFGGEGQGFPGGGQAAALQEMLKGQGMGGMGGMGGMDGADQAAAL
QEMLKGQGMGGMGDMGGMGGADQAAALQELLKNSGQGLEGLDELEEEHDLDEELAEEEKA
PEST
Download sequence
Identical sequences A0A1G4MKW8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]