SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G5R9P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G5R9P6
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 5.93e-40
Family Frataxin-like 0.00000725
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G5R9P6
Sequence length 106
Comment (tr|A0A1G5R9P6|A0A1G5R9P6_PHOLU) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142, ECO:0000256|SAAS:SAAS01015787} KW=Complete proteome OX=29488 OS=Photorhabdus luminescens (Xenorhabdus luminescens). GN=SAMN02982990_03415 OC=Morganellaceae; Photorhabdus.
Sequence
MNDSEFHQLADQLMVYIEGQLDNYDGNADIDCETNGGVMTLSFDNDSKIIINRQEPFHQI
WLATKSGGYHFDYKEGQWICDRSGDNFLTMLAHAITEQSGEQFSFL
Download sequence
Identical sequences A0A1G5R9P6
WP_049585410.1.25635 WP_049585410.1.80160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]