SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G7TH76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G7TH76
Domain Number 1 Region: 30-103
Classification Level Classification E-value
Superfamily YdhA-like 6.15e-16
Family YdhA-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G7TH76
Sequence length 219
Comment (tr|A0A1G7TH76|A0A1G7TH76_9PROT) Putative lipoprotein {ECO:0000313|EMBL:SDG33880.1} KW=Complete proteome; Reference proteome OX=1082479 OS=Limimonas halophila. GN=SAMN05216241_10959 OC=Rhodospirillaceae; Limimonas.
Sequence
MVVRGAVASAIALVVAGCAGGEKPEDAPARVAAYRCDGGGRVEALFRGGDTLRLFPPGGH
ATRLTRARSASGARYTGGGLTFWDKGDTALLSRGGAAPLECERTGKRAAWADAAVQGGRF
RALGQEPGWLVTVGADRITAKLDYGRTVVRAPSPEPTKRADTTTWTTQTGDGRQLGIIAR
DEACRDAMSGHRFPMTVTLRLGDRRYRGCGRWLVADHPA
Download sequence
Identical sequences A0A1G7TH76
WP_090020952.1.11360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]