SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G8D3X9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G8D3X9
Domain Number 1 Region: 48-127
Classification Level Classification E-value
Superfamily FlaG-like 3.4e-22
Family FlaG-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G8D3X9
Sequence length 142
Comment (tr|A0A1G8D3X9|A0A1G8D3X9_9VIBR) Flagellar protein FlaG {ECO:0000313|EMBL:SDH52234.1} KW=Complete proteome; Reference proteome OX=861298 OS=Vibrio xiamenensis. GN=SAMN04488136_11879 OC=Vibrionaceae; Vibrio.
Sequence
MELSSYTSNVQPYGSQSGTKIASKNDNAQSISSQNEGNAVTEVTEQATQSVDKAIERTQM
RERLNREERQKLVDQMNEFISSINTGLSFRVDEESGREVVTIYEAQTGDIIRQIPDEEML
EVLRRLRVQTARYSSGLVNDKV
Download sequence
Identical sequences A0A1G8D3X9
WP_093275581.1.73841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]