SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G8Z8M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G8Z8M4
Domain Number 1 Region: 18-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.000000000000432
Family Preprotein translocase SecE subunit 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1G8Z8M4
Sequence length 69
Comment (tr|A0A1G8Z8M4|A0A1G8Z8M4_9EURY) Protein translocase subunit secE/sec61 gamma {ECO:0000313|EMBL:SDK11411.1} OX=2200 OS=Methanoculleus thermophilus. GN=SAMN04488571_10431 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MMDYKEKFNEVKSIKIEEELFKKYWRVLKLARTPTRDEFSKIAIVAAAGIMLIGLVGFII
YEIMLVMPK
Download sequence
Identical sequences A0A1G8Z8M4
WP_066957629.1.56428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]