SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G9KHU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G9KHU7
Domain Number 1 Region: 45-139
Classification Level Classification E-value
Superfamily NosL/MerB-like 1.31e-18
Family NosL-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G9KHU7
Sequence length 147
Comment (tr|A0A1G9KHU7|A0A1G9KHU7_9FLAO) Copper chaperone NosL {ECO:0000313|EMBL:SDL49097.1} KW=Complete proteome; Reference proteome OX=192904 OS=Kriegella aquimaris. GN=SAMN04488514_101992 OC=Flavobacteriaceae; Kriegella.
Sequence
MKSYLLLLLLSVFTFMSCTVKPEPIAYGSDGCHFCSMTIVDQQHAAQIVTSKGKAFKFDA
AECMMNYLRDMNTADVALYLTNTYNRPGELIDATKATYLVSKNIPSPMGEFLTAFDSEES
AKNVQSESQGELFSWQELKNHFDSKKK
Download sequence
Identical sequences A0A1G9KHU7
WP_089885937.1.7895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]