SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1G9PP81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G9PP81
Domain Number 1 Region: 27-109
Classification Level Classification E-value
Superfamily Barstar-related 0.000000000000994
Family Barstar-related 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G9PP81
Sequence length 118
Comment (tr|A0A1G9PP81|A0A1G9PP81_9MICC) Barstar (Barnase inhibitor) {ECO:0000313|EMBL:SDM00648.1} KW=Complete proteome OX=1761748 OS=Arthrobacter sp. ov407. GN=SAMN04487916_1216 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Arthrobacter.
Sequence
MKIYSADTWTIEELTAQIDDAGRRAFVVPAADTKQAVLDTFGELLDSPEDYGTDLDALHD
SLHDVADAVTDDGEAPVTFIWQVPAALRADRSFAVICETLQDAEGYAGNSLDVIAVCL
Download sequence
Identical sequences A0A1G9PP81
WP_090583985.1.59023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]