SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H0UUR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H0UUR5
Domain Number 1 Region: 17-113
Classification Level Classification E-value
Superfamily FlaG-like 1.83e-23
Family FlaG-like 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1H0UUR5
Sequence length 113
Comment (tr|A0A1H0UUR5|A0A1H0UUR5_9CLOT) Flagellar protein FlaG {ECO:0000313|EMBL:SDP69526.1} KW=Complete proteome; Reference proteome OX=94869 OS=Clostridium gasigenes. GN=SAMN04488529_11286 OC=Clostridium.
Sequence
MELKAMSESGQVATEIKKADFKQMKSIKTTEGTSKDKGYKEEDIAKALVKLNKFLQEDNT
SAEYSVHEVFGDIMIKIIDNDTKEVLMELPPKKILDLVAKMCERAGVIVDKKA
Download sequence
Identical sequences A0A1H0UUR5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]