SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H1NW03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H1NW03
Domain Number 1 Region: 81-195
Classification Level Classification E-value
Superfamily NosL/MerB-like 1.33e-18
Family MerB-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1H1NW03
Sequence length 221
Comment (tr|A0A1H1NW03|A0A1H1NW03_9MICO) Alkylmercury lyase {ECO:0000313|EMBL:SDS02970.1} KW=Complete proteome OX=589382 OS=Agromyces flavus. GN=SAMN04489721_0667 OC=Bacteria; Actinobacteria; Micrococcales; Microbacteriaceae; Agromyces.
Sequence
MNDRDEAVRLAVYRALAATGRLPGIDELAVTTSLEPSEVEESLEALATARHVVFDGDHRI
VLAHPFATRNFAFSVMGERTLWWGGCAWDAFAIPHLVPDEPSALIATTCPACGAAHSWTV
TREAAPDGPQVAHFLTPVAHIWDDVVHACEHQRVFCSSEHVDDWLERTGNDHGYVMDLAT
LWRLAAHWYEGRLDSPYRRREPVEAREYFASVGLTGAFWGN
Download sequence
Identical sequences A0A1H1NW03
WP_092669246.1.57868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]