SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H5I2Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H5I2Y4
Domain Number 1 Region: 6-71
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.000000000000759
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1H5I2Y4
Sequence length 195
Comment (tr|A0A1H5I2Y4|A0A1H5I2Y4_9PSED) Anti sigma-E protein, RseA {ECO:0000313|EMBL:SEE33848.1} KW=Complete proteome OX=132476 OS=Pseudomonas kilonensis. GN=SAMN04490188_3450 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSREALQESLSAVMDNEADELELRRVLNAFDDVETRETWARYQIARAVMHKDLLLPRLDI
AAAVSAALADEAVPAKASRGPWRSLGRLAVAASVTVAVLAGVRLYNQDEIAGVQMAQQSN
QPGLAAPQVKGPAVLAGYSEGSETAGPMVNGVLQGQPGWHDQRLPNYLRQHAQQAALKGT
ESALPYARAASLENR
Download sequence
Identical sequences A0A1H5I2Y4 A0A1I4D5Z5 A0A1I5IM35 A0A1K1RPB0 G8PYE7 G9HQL6
gi|378949346|ref|YP_005206834.1| WP_014337028.1.10399 WP_014337028.1.16422 WP_014337028.1.18477 WP_014337028.1.23095 WP_014337028.1.24733 WP_014337028.1.37263 WP_014337028.1.39650 WP_014337028.1.44965 WP_014337028.1.45064 WP_014337028.1.58310 WP_014337028.1.61085 WP_014337028.1.66223 WP_014337028.1.9069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]