SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H5Y0Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H5Y0Q5
Domain Number 1 Region: 16-104
Classification Level Classification E-value
Superfamily Barstar-related 2.09e-23
Family Barstar-related 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1H5Y0Q5
Sequence length 127
Comment (tr|A0A1H5Y0Q5|A0A1H5Y0Q5_9RHOO) Barstar (Barnase inhibitor) {ECO:0000313|EMBL:SEG17190.1} OX=96773 OS=Thauera chlorobenzoica. GN=SAMN05216242_12223 OC=Zoogloeaceae; Thauera.
Sequence
MSALPPTPANPDIVAVTIALDGCASKAELLERIAAALHFPGWFGHNWDALADCLTDLSWL
PAGAYRITLTQAAPLRRAAPETLATALEIFDAAAAAWADQGVDFRVCLTEDGADDGTAPP
AAPAARQ
Download sequence
Identical sequences A0A1H5Y0Q5
WP_075148127.1.3434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]