SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1H6TF60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1H6TF60
Domain Number - Region: 25-57
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0209
Family Capz beta-1 subunit 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1H6TF60
Sequence length 97
Comment (tr|A0A1H6TF60|A0A1H6TF60_BACTU) Uncharacterized protein {ECO:0000313|EMBL:AQY37447.1} KW=Complete proteome OX=1428 OS=Bacillus thuringiensis. GN=B4918_05295 OC=Bacillus cereus group.
Sequence
MTIREEGLIVKDQVLSCYLKGKRCLFVIVKILKDSSNSFLCTVQNKNGDQYVKKWFSKHE
NNKELGRPTFKEVEKDWKENRESFMYPNIKALYSNGT
Download sequence
Identical sequences A0A1H6TF60 A0A2H3QW26 R8SGX6
WP_000155359.1.22084 WP_000155359.1.27446 WP_000155359.1.36279 WP_000155359.1.4355 WP_000155359.1.6241 WP_000155359.1.70667 WP_000155359.1.73638 WP_000155359.1.87649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]